SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397657097|ref|YP_006497799.1| from Klebsiella oxytoca E718

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397657097|ref|YP_006497799.1|
Domain Number 1 Region: 10-115
Classification Level Classification E-value
Superfamily MOSC N-terminal domain-like 1.57e-22
Family MOSC N-terminal domain-like 0.022
Further Details:      
 
Domain Number 2 Region: 267-350
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 7.6e-21
Family 2Fe-2S ferredoxin-related 0.028
Further Details:      
 
Domain Number 3 Region: 130-247
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 0.0000000000000732
Family MOSC (MOCO sulphurase C-terminal) domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397657097|ref|YP_006497799.1|
Sequence length 352
Comment flavodoxin reductases (ferredoxin-NADPH reductases) family 1 [Klebsiella oxytoca E718]
Sequence
MGLSHAYADSSGLAFDRIFMVTETDGTFITARQFPQMVKFIPAPLHDGLHLTAPDGSSAM
VRFSDFSIQQEPTEVWGNHFTALIAPDRVNQWLSGFFNRSVQLRWLGPALSRRVKRHDAV
PLSFADGFPYLLANEASLRDLQNRCPASVSIEQFRPNLLVTGAAAWEEDTWKVVRIGEVI
FDVVKPCSRCVLTTVSPERGQKHPSGEPLSTLQRFRTALDNGDVDFGQNLIARNSGVIRV
GDALEVLARGPAKAYGAGESDTTPAPEAQENATVEIAWQGVSFTGNNQQILLEQLEQQGI
RIPYSCRAGICGSCRIRLEEGEVSALKKNAVAADGTILCCSCVPKTAVRLAP
Download sequence
Identical sequences gi|397657097|ref|YP_006497799.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]