SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397657598|ref|YP_006498300.1| from Klebsiella oxytoca E718

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397657598|ref|YP_006498300.1|
Domain Number 1 Region: 23-249
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.63e-47
Family Phosphate binding protein-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397657598|ref|YP_006498300.1|
Sequence length 331
Comment alkanesulfonates-binding protein [Klebsiella oxytoca E718]
Sequence
MGKSFLAVLISGVLFNAADAADSQPLRIGWVYALANAPALIAEKEGFYQQEGLTVELKSF
GDGPVISQALAAHELDAAYMGATPVFQWFSRGLKGQIIAKVNSGQAALIVPAQSAISRLA
DLKGKRIAGVKKGSGMDVLLRGVVLQQQAGLVADKDAQILSMPAGNMPAALQQGVVDAAF
TWEPFVSEALLRGDARLLLDVNKVQPGYPWYVLMALPETLKDRPDDVVKLIRAHQKAVDF
INQHPAEADRIMADAFKLRAIKTADGKTLPPEALVQEARKRIEWSVSLTKKDGAFFEQLM
KDSQTLGYMQKAPELNEFVDTQWLTKAGITQ
Download sequence
Identical sequences A0A068HAC5 A0A0H3HAJ0 A0A1D8JT54 A0A249WQY2 A0A2I8WEU7
gi|397657598|ref|YP_006498300.1| WP_014229041.1.10517 WP_014229041.1.12043 WP_014229041.1.12607 WP_014229041.1.12666 WP_014229041.1.16033 WP_014229041.1.16221 WP_014229041.1.18200 WP_014229041.1.18452 WP_014229041.1.20013 WP_014229041.1.21019 WP_014229041.1.2675 WP_014229041.1.27905 WP_014229041.1.31371 WP_014229041.1.40069 WP_014229041.1.45119 WP_014229041.1.56093 WP_014229041.1.63981 WP_014229041.1.64237 WP_014229041.1.6818 WP_014229041.1.72569 WP_014229041.1.75060 WP_014229041.1.8153 WP_014229041.1.88526 WP_014229041.1.89623 WP_014229041.1.92269 gi|375260518|ref|YP_005019688.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]