SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397657635|ref|YP_006498337.1| from Klebsiella oxytoca E718

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397657635|ref|YP_006498337.1|
Domain Number 1 Region: 25-246
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.52e-39
Family Phosphate binding protein-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397657635|ref|YP_006498337.1|
Sequence length 335
Comment hypothetical protein A225_2621 [Klebsiella oxytoca E718]
Sequence
MNKSLCVLLAAGGLWVNSSFAETPAEVRVAYSGGSQVLMLAKADGSLDKALNSKVKWVQF
ASGADALNYFASNAIDIANFGSSPATAGIVRKLPVEIIGVSGVIASYERLIGKDGIASIK
DIEGKRVAYPPNSTAQYALEAAISVNHLDRSKITLLPLRPAEMVAAWKRGDIDAGYVWAP
FAQELETSGGHQVFATKDLQKDGYLIYNNYVVRKAFAEQYPQTVSAFLRVHQQKVDEFKK
DPERAAAIVAKEVGAPVTTAVNTLGGLEYPTLSQQGTAQWLGNGTQTTDSGIGKALTKTS
HFLADIGEIRQRDIPASWDSAINSRYIRDAAVAAQ
Download sequence
Identical sequences A0A068HBF0 A0A0H3HD99 A0A1F2HTQ7 A0A249WQK7 A0A2I8WES7
gi|375260541|ref|YP_005019711.1| gi|397657635|ref|YP_006498337.1| WP_014229064.1.100056 WP_014229064.1.102027 WP_014229064.1.10517 WP_014229064.1.12607 WP_014229064.1.12666 WP_014229064.1.13288 WP_014229064.1.16221 WP_014229064.1.17303 WP_014229064.1.18200 WP_014229064.1.18452 WP_014229064.1.20013 WP_014229064.1.21019 WP_014229064.1.2675 WP_014229064.1.27905 WP_014229064.1.31371 WP_014229064.1.35980 WP_014229064.1.36474 WP_014229064.1.37412 WP_014229064.1.45077 WP_014229064.1.45119 WP_014229064.1.48038 WP_014229064.1.56093 WP_014229064.1.63855 WP_014229064.1.64237 WP_014229064.1.67927 WP_014229064.1.6818 WP_014229064.1.72569 WP_014229064.1.88526 WP_014229064.1.89623 WP_014229064.1.92088 WP_014229064.1.92269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]