SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397657876|ref|YP_006498578.1| from Klebsiella oxytoca E718

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397657876|ref|YP_006498578.1|
Domain Number 1 Region: 24-290
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.96e-62
Family Phosphate binding protein-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397657876|ref|YP_006498578.1|
Sequence length 322
Comment Ferric iron ABC transporter [Klebsiella oxytoca E718]
Sequence
MKTVITVTKGAALAMMLSATTISSAQALTVYTAGPGSLAKNLASGYEKKTGVKVNIFQAT
TGKVMARLEAEQANPQADVLISASWDTAEDLHHRGWLLPYQSANADKVPANLKSADYVAQ
GISALGIVWNTKSGTPEPKEWRDLTEAAFKDKVTTPDPALSGASLDLLIGLQNGMGDKAW
ALFDALKKNGMVVSGPNAQAVTPVMQGAKAAVFGAVDYVSYGNIHQGESLKVIFPASGTV
IAPRPMMILKTSQHADDAKAFVDYVLSPEGQALVADAWLMPARSDVPAKRPLLNELKILP
TAGEGTSERSAVLSRFNTLFAQ
Download sequence
Identical sequences A0A068HC59 A0A249WQ01 A0A2I8WE18
gi|397657876|ref|YP_006498578.1| WP_014838417.1.12043 WP_014838417.1.16221 WP_014838417.1.18452 WP_014838417.1.20013 WP_014838417.1.40069 WP_014838417.1.45119 WP_014838417.1.6818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]