SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397657943|ref|YP_006498645.1| from Klebsiella oxytoca E718

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397657943|ref|YP_006498645.1|
Domain Number 1 Region: 26-303
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.11e-49
Family Phosphate binding protein-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397657943|ref|YP_006498645.1|
Sequence length 311
Comment hydroxymethylpyrimidine ABC transporter [Klebsiella oxytoca E718]
Sequence
MRKRIYAGMTLAALFSGQALANEKLTLVLDWYINPDHAPILVAEQIGAFKDAGLDVDIVP
PSDPALPPRLVAARQADLAITYQPQVHFFADEGLPLVRVGTLINSPLNTVIALDKSIKSP
ADLQGKKVGYSVSGIEQATLATMAQHAKIDPKSIKLINVNFQLTSALLAGQVDAVIGGYR
NIEALELKLQGKDPQVMNVEDYGVPAYDELVIVANRDEVHAAKIRAFLKALQKGVAYLRA
HPQETWQAFAAAHPELNTELNKQAWLKTLPLFASDPAALDKPRYEAYEQFLYNNKLVKKV
TPLTNYAVELH
Download sequence
Identical sequences A0A068HIG8 A0A1D8JU20 A0A249WPW2 A0A2I8WE02
WP_014838463.1.16033 WP_014838463.1.16221 WP_014838463.1.18200 WP_014838463.1.18452 WP_014838463.1.20013 WP_014838463.1.40069 WP_014838463.1.45119 WP_014838463.1.6818 WP_014838463.1.75060 WP_014838463.1.8153 WP_014838463.1.89623 gi|397657943|ref|YP_006498645.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]