SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397658309|ref|YP_006499011.1| from Klebsiella oxytoca E718

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397658309|ref|YP_006499011.1|
Domain Number 1 Region: 89-290
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 9.23e-27
Family Phosphate binding protein-like 0.0061
Further Details:      
 
Domain Number 2 Region: 6-88
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.44e-19
Family LysR-like transcriptional regulators 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397658309|ref|YP_006499011.1|
Sequence length 303
Comment lysR-family transcriptional regulator YdhB [Klebsiella oxytoca E718]
Sequence
MWSEYSLEVVDAVARNGSFSAAAQELHRVPSAVSYTVRQLEEWLAVPLFERRHRDVELTP
AGVWFLQEGRSVIKKMQITRQQCQQIANGWRGQLSIAVDNIVKPTRMRQMIVDFYRHFDD
VELIVFQEVFNGVWDALADGRVELAIGATRSIPVGGRYAFRDMGMLSWDCVVASHHPLAQ
MAGPLSDDVLRNWPSLVREDTSRSLPKRTTWLLDNQKRVVVPDWDASETCLSAGLCVGMV
PGHLARPWLDSGAWTALELENPFPDAACCLTWQQSDASPALLWLLDYLGDSETLNREWLR
APE
Download sequence
Identical sequences A0A068HDB3 A0A0H3HF83 A0A1D8JV00 A0A1F2HS99 A0A249WNS0 A0A2I8X484
gi|375261217|ref|YP_005020387.1| WP_014229606.1.12043 WP_014229606.1.12607 WP_014229606.1.13288 WP_014229606.1.16033 WP_014229606.1.16221 WP_014229606.1.18200 WP_014229606.1.18452 WP_014229606.1.20013 WP_014229606.1.21019 WP_014229606.1.31371 WP_014229606.1.35980 WP_014229606.1.37412 WP_014229606.1.40069 WP_014229606.1.45119 WP_014229606.1.56093 WP_014229606.1.64237 WP_014229606.1.67927 WP_014229606.1.6818 WP_014229606.1.75060 WP_014229606.1.8153 WP_014229606.1.88526 WP_014229606.1.89623 WP_014229606.1.92269 gi|397658309|ref|YP_006499011.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]