SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397658390|ref|YP_006499092.1| from Klebsiella oxytoca E718

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397658390|ref|YP_006499092.1|
Domain Number 1 Region: 3-248
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.84e-67
Family Phosphate binding protein-like 0.0000603
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397658390|ref|YP_006499092.1|
Sequence length 255
Comment glutamine ABC transporter [Klebsiella oxytoca E718]
Sequence
MVKKWMKACCLVAAMIGTAHAAQQTYVVGSGGTYRPFEFENSQKQLEGFDIDIIKAIAKA
EGFDIKLVNTPWEGIFATLNTGDRDIIISGITITDKRKQMVDFSAPYFPAEQSIVVPADS
KVSSLEALKNEKVGVVNSSTGDIVVSDVLGKNSTAIKRFDNTPLMLQELFEDGVSAAVGD
VGVVKYYIKQHPEKQFKLVPDAKFERQYFGIAVAKGNSELQAKINAGLQKIIADGTYAKI
YKTWFDENVPTLPAQ
Download sequence
Identical sequences A0A068HFK6 A0A0G3S981 A0A0H3HCQ4 A0A1D8JV65 A0A1F2I0I8 A0A1Q8YMX9 J6HWD0
gi|375261303|ref|YP_005020473.1| WP_004851663.1.100056 WP_004851663.1.101164 WP_004851663.1.102027 WP_004851663.1.10264 WP_004851663.1.10517 WP_004851663.1.12043 WP_004851663.1.12607 WP_004851663.1.12666 WP_004851663.1.13288 WP_004851663.1.16033 WP_004851663.1.16221 WP_004851663.1.17303 WP_004851663.1.18200 WP_004851663.1.18452 WP_004851663.1.20013 WP_004851663.1.20800 WP_004851663.1.21019 WP_004851663.1.2675 WP_004851663.1.27905 WP_004851663.1.31371 WP_004851663.1.35980 WP_004851663.1.36474 WP_004851663.1.37113 WP_004851663.1.37412 WP_004851663.1.40069 WP_004851663.1.41184 WP_004851663.1.45077 WP_004851663.1.45119 WP_004851663.1.48038 WP_004851663.1.51564 WP_004851663.1.56052 WP_004851663.1.56093 WP_004851663.1.61996 WP_004851663.1.62898 WP_004851663.1.63855 WP_004851663.1.63981 WP_004851663.1.64237 WP_004851663.1.67927 WP_004851663.1.6818 WP_004851663.1.68620 WP_004851663.1.71148 WP_004851663.1.72569 WP_004851663.1.73975 WP_004851663.1.75060 WP_004851663.1.8153 WP_004851663.1.83138 WP_004851663.1.85983 WP_004851663.1.88526 WP_004851663.1.89623 WP_004851663.1.92269 WP_004851663.1.98530 gi|397658390|ref|YP_006499092.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]