SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397658422|ref|YP_006499124.1| from Klebsiella oxytoca E718

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397658422|ref|YP_006499124.1|
Domain Number 1 Region: 4-241
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.09e-33
Family Phosphate binding protein-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397658422|ref|YP_006499124.1|
Sequence length 246
Comment Molybdenum-binding periplasmic protein [Klebsiella oxytoca E718]
Sequence
MTPSLTLLAAGSLKSAFIPLLARFQQQTGIPVEVHFGPAGLLRERIEGGEPCSVFASANS
QHPQALRQAGLAGACYLFARNQLMLTARHGATTETREWLALLSDPDLRLATSTPGCDPSG
DYTWQLFSHIEERCPGVGAAIMARARPLVGGRDSLPVPAGEIAGAWLIRENLTDLFIGYA
HYAAQMAACSDLRTLLIPPAWNVRCDYLLAQIEQSAGAQRLCRFILGAEGQRLLKDAGFL
PISDES
Download sequence
Identical sequences A0A0H3HAF9 A0A249WNF3
gi|397658422|ref|YP_006499124.1| gi|375261331|ref|YP_005020501.1| WP_014229704.1.12607 WP_014229704.1.18452 WP_014229704.1.31371 WP_014229704.1.40069 WP_014229704.1.56093 WP_014229704.1.64237 WP_014229704.1.6818 WP_014229704.1.92269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]