SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397658744|ref|YP_006499446.1| from Klebsiella oxytoca E718

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397658744|ref|YP_006499446.1|
Domain Number 1 Region: 92-297
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.07e-40
Family Phosphate binding protein-like 0.019
Further Details:      
 
Domain Number 2 Region: 6-90
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.34e-20
Family LysR-like transcriptional regulators 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397658744|ref|YP_006499446.1|
Sequence length 300
Comment transcriptional regulator [Klebsiella oxytoca E718]
Sequence
MMSKEKLNDLQAFATVAHERSFTRAAAILGVSRSALSHTLLALEARLGVRLLIRTTRSVS
PTDAGNRLLAVLAPRLNEIEAELASLRASRDKPAGTVRITANDHAIVTVLWPRLRPLLTQ
YPDIHIEFSVGYELTDIAAQRFDAGVRMGDQVDKDMIAVRITPDVQMAVVAAPAYLAGRA
AVRRPEDLMAHNCVNLRLPTHGALYAWEFEKGSQKTRVRVDGQTVFNNTFLMIQAALDGA
GIAYVPHDLAAKYIATGELVPLLADWCPHFPGYYLYYPGRQHLPAAFTLVVDALRWHRRG
Download sequence
Identical sequences A0A1D8JW56 A0A249WMT4 A0A2I8WRW9
gi|397658744|ref|YP_006499446.1| WP_014838860.1.12043 WP_014838860.1.16033 WP_014838860.1.18452 WP_014838860.1.21019 WP_014838860.1.6818 WP_014838860.1.75060 WP_014838860.1.8153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]