SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397659472|ref|YP_006500174.1| from Klebsiella oxytoca E718

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397659472|ref|YP_006500174.1|
Domain Number 1 Region: 14-264
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.76e-45
Family Phosphate binding protein-like 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397659472|ref|YP_006500174.1|
Sequence length 267
Comment Arginine ABC transporter [Klebsiella oxytoca E718]
Sequence
MNKTLKKISRRVALSIAVTACFSPLAQAAELLTEGVFKVGMEVTYPPFESYDSNNNIVGI
DPEFAALIAEQLKAKPQLIDTKFTSLILGIGKKYDAVISGMYVTPERQKQADAIPYALSG
ASIIALKSSAIQPKTEDELCGVKVGLQAGTAWVSSLKTHSDEYCLKNGKPAISIQEFPTA
PEASQALLSKNINAQLEIAPAAQIIVEKSRGRLAISSNRLVYPLPLGIYVAKGNTELAEA
IKSTLATLKANGKYDTIIKKYNLESIN
Download sequence
Identical sequences A0A249WL61
WP_014839261.1.18452 WP_014839261.1.6818 gi|397659472|ref|YP_006500174.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]