SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397659515|ref|YP_006500217.1| from Klebsiella oxytoca E718

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397659515|ref|YP_006500217.1|
Domain Number 1 Region: 24-329
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.21e-97
Family Phosphate binding protein-like 0.0000000000763
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397659515|ref|YP_006500217.1|
Sequence length 331
Comment L-proline glycine betaine binding ABC transporter protein ProX [Klebsiella oxytoca E718]
Sequence
MRHTAILATALTALISTTAFAADLPGKGITVKPIQSTISEETFQTLLVSRALEKLGYTVD
KPSEVDYNVGYTSLASGDATFTAVNWQPLHDDMYAAAGGDKKFYREGVFVNGAAQGYLID
KKTAEQYHIKSIDQLKDPKIAKLFDTNGDGKADLTGCTPGWGCEAVINHQLDAYGLNNTV
THNQGNYAAMMADTIARYKEGKPVIYYTWTPYWVSDVLKPGKDVVWLQVPFSSLPGEQKD
IDTKLPNGMNYGFPVNTMHIVANKAWAEKNPAAAKLFSIMKLPIADINAENAMMHAGHGS
EADIQGHVDGWIKAHQQQFDGWVEEALAAQK
Download sequence
Identical sequences A0A068HGT1 A0A249WKS0 A0A2I8W9E3
WP_014839294.1.18452 WP_014839294.1.20013 WP_014839294.1.21019 WP_014839294.1.6818 gi|397659515|ref|YP_006500217.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]