SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397659955|ref|YP_006500657.1| from Klebsiella oxytoca E718

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397659955|ref|YP_006500657.1|
Domain Number 1 Region: 75-121,156-270
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.0000426
Family Phosphate binding protein-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397659955|ref|YP_006500657.1|
Sequence length 328
Comment TRAP-type C4-dicarboxylate transport system [Klebsiella oxytoca E718]
Sequence
MKKLSFSRSLACVSLLALLASGASAAEKVTLKLAHNLERSHVVHQAFEAMSKEVNQLSNG
DMKIRIYPSSQMGSARETMELLQNGALDMTKGSASDLESFDNVYAIYNLPFLFKDQNHFN
KVVFGDVGKEIMESTKDKGFFALSAYVAGTRSFYAKKPITKPEDLKGLKIRVQASPTTLK
MVELMGGSPTPISFGEVYTAMQQGVVDGAENNVPSWVQTRHIEIAKVFSEDEHASIPDFL
VISSKTWDKLTPDQQQILIKAAKASEAYQQKLWDKIDADTRAQAKAMGGEIIKVDKAPFR
AAVQPLFDEFKKDPKQAALLAKFEAAAE
Download sequence
Identical sequences A0A068HIA4 A0A0G3S7F9 A0A0J2HIX3 A0A1F2HZI5
gi|397659955|ref|YP_006500657.1| WP_014839537.1.101164 WP_014839537.1.12043 WP_014839537.1.12666 WP_014839537.1.13288 WP_014839537.1.16221 WP_014839537.1.17303 WP_014839537.1.18452 WP_014839537.1.20013 WP_014839537.1.20800 WP_014839537.1.21019 WP_014839537.1.2675 WP_014839537.1.27905 WP_014839537.1.35980 WP_014839537.1.36477 WP_014839537.1.37412 WP_014839537.1.40108 WP_014839537.1.41184 WP_014839537.1.45119 WP_014839537.1.53171 WP_014839537.1.62898 WP_014839537.1.63981 WP_014839537.1.67927 WP_014839537.1.6818 WP_014839537.1.68620 WP_014839537.1.80555 WP_014839537.1.83138 WP_014839537.1.89623 WP_014839537.1.98530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]