SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397660765|ref|YP_006501467.1| from Klebsiella oxytoca E718

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397660765|ref|YP_006501467.1|
Domain Number 1 Region: 29-335
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.27e-95
Family Phosphate binding protein-like 0.0000000000793
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397660765|ref|YP_006501467.1|
Sequence length 346
Comment phosphate ABC transporter [Klebsiella oxytoca E718]
Sequence
MNVMRTTVATVVAATLSMSAFSVFAAASLTGAGATFPAPVYAKWADTYNKETGNKVNYQG
IGSSGGVKQITANTVDFGASDAPLADDKLAQEGLFQFPTVIGGVVLAINLPGVKSGELVL
DGKTLGDIYLGKIKKWDDAAIAKLNPGMKLPSQNIAVVRRADGSGTSFVFTSYLAKVNEE
WKSKIGAGSTVNWPTGLGGKGNDGIAAFVQRLPGSIGYVEYAYAKQNNLAYTKLLSADGK
PVSPTEDNFANAAKEIDWSKSFAQDLTNQKGDNAWPITSTTFILVHKASNKPEQTAEVLK
FFDWAYKNGGKEANALDYATLPESVVEQVRAAWKTNVKDSSGKALY
Download sequence
Identical sequences A0A068HR65 A0A0G3S0F9 A0A0H3H9T8 A0A1D8K1H5 A0A1F2HLT0 H3N4Z7 J6IFJ5
WP_004127017.1.100056 WP_004127017.1.101164 WP_004127017.1.102027 WP_004127017.1.10264 WP_004127017.1.10517 WP_004127017.1.12043 WP_004127017.1.12607 WP_004127017.1.12666 WP_004127017.1.13288 WP_004127017.1.13497 WP_004127017.1.16033 WP_004127017.1.16221 WP_004127017.1.16967 WP_004127017.1.17303 WP_004127017.1.18452 WP_004127017.1.20013 WP_004127017.1.20739 WP_004127017.1.20800 WP_004127017.1.21019 WP_004127017.1.23223 WP_004127017.1.27905 WP_004127017.1.31018 WP_004127017.1.31371 WP_004127017.1.35323 WP_004127017.1.35980 WP_004127017.1.36474 WP_004127017.1.36477 WP_004127017.1.37113 WP_004127017.1.37412 WP_004127017.1.37609 WP_004127017.1.40069 WP_004127017.1.40108 WP_004127017.1.40423 WP_004127017.1.41184 WP_004127017.1.41890 WP_004127017.1.43818 WP_004127017.1.45077 WP_004127017.1.45119 WP_004127017.1.48038 WP_004127017.1.50753 WP_004127017.1.51564 WP_004127017.1.53171 WP_004127017.1.56052 WP_004127017.1.56093 WP_004127017.1.60497 WP_004127017.1.61996 WP_004127017.1.62898 WP_004127017.1.63855 WP_004127017.1.63981 WP_004127017.1.64237 WP_004127017.1.659 WP_004127017.1.66748 WP_004127017.1.67927 WP_004127017.1.6818 WP_004127017.1.68620 WP_004127017.1.69050 WP_004127017.1.71148 WP_004127017.1.71552 WP_004127017.1.72569 WP_004127017.1.73975 WP_004127017.1.75060 WP_004127017.1.78483 WP_004127017.1.80555 WP_004127017.1.8153 WP_004127017.1.8186 WP_004127017.1.82628 WP_004127017.1.83138 WP_004127017.1.85983 WP_004127017.1.88526 WP_004127017.1.89153 WP_004127017.1.92088 WP_004127017.1.92155 WP_004127017.1.92269 WP_004127017.1.98530 WP_004127017.1.98660 WP_004127017.1.99408 gi|375258134|ref|YP_005017304.1| gi|397660765|ref|YP_006501467.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]