SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428207306|ref|YP_007091659.1| from Chroococcidiopsis thermalis PCC 7203

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428207306|ref|YP_007091659.1|
Domain Number 1 Region: 11-140
Classification Level Classification E-value
Superfamily Ava3019-like 3.4e-38
Family Ava3019-like 0.0000309
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428207306|ref|YP_007091659.1|
Sequence length 141
Comment hypothetical protein Chro_2298 [Chroococcidiopsis thermalis PCC 7203]
Sequence
MSQPLSDRFAIASAQKLLETFSCLEVKPVESAAEAAQLQQALILLSTQADFVNFGICADT
PEQGLAALASYAKALGYTVAIAPHDLAAAIAPVYIKFNGQRQTYYLDSYTGTYRGVLVSY
HSLVEESVNGTYGYLPLDLFQ
Download sequence
Identical sequences K9TZ10
gi|428207306|ref|YP_007091659.1| WP_015154338.1.72800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]