SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|375260392|ref|YP_005019562.1| from Klebsiella oxytoca KCTC 1686

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375260392|ref|YP_005019562.1|
Domain Number 1 Region: 19-276,372-403
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.92e-73
Family Type II chitinase 0.0000469
Further Details:      
 
Weak hits

Sequence:  gi|375260392|ref|YP_005019562.1|
Domain Number - Region: 317-356
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.0016
Family Chitinase insertion domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|375260392|ref|YP_005019562.1|
Sequence length 417
Comment chitinase [Klebsiella oxytoca KCTC 1686]
Sequence
MKLLPLLAALPLLCASVVSANSLMSVGYFNGGGDVTAGPGGDIDKLDVRQITHLNYSFGL
VYNDEKDETNAALKDPSKLHQIWLSPKVQADLQKIPRLRQQNPNLKVLLSVGGWGARGFS
GAAATKETRAVFIQSAQAIIEKYGLDGIDLDWEYPVNGAWGLVASQPADRDNFTALLKEL
RAAVGNKKLVTIAVGANAESPKSWVDVKAIAPSLDYINLMTYDLAYGTQYFNSNLYDSTR
WPTVAEADKYSADFIVNNYLAAGLKASQMNLGIGFYGRIPKRAVEPGIDWSKPDAQKNPA
TRPYFAAQQIELFESLGVDLTKDTYVKYNDIVAKLINDPQKRFTQHWDDEAKVPWLSVQS
ADGQALFALSYENPRSVAIKADYIKSKGLGGAMFWEYGADDQNQLAKQLAESLGIKR
Download sequence
Identical sequences A0A0H3HAA7
gi|375260392|ref|YP_005019562.1| WP_014228952.1.12607 WP_014228952.1.31371 WP_014228952.1.36474 WP_014228952.1.56093 WP_014228952.1.64237 WP_014228952.1.88526 WP_014228952.1.89623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]