SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|375258920|ref|YP_005018090.1| from Klebsiella oxytoca KCTC 1686

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375258920|ref|YP_005018090.1|
Domain Number 1 Region: 145-262,298-332
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 8.09e-22
Family Adenylyltransferase 0.021
Further Details:      
 
Domain Number 2 Region: 24-126
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000000000691
Family N-acetyl transferase, NAT 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|375258920|ref|YP_005018090.1|
Sequence length 342
Comment citrate lyase synthetase [Klebsiella oxytoca KCTC 1686]
Sequence
MNLIVKRVAVQLDPRRREAVDLFLHQHQLTLEADCEWAIIVEYQRRIVGCGAIAGCVLKC
IAVDPSLQGEGLSLKLLTELMTLAYELGRSELFLFTKPYNAALFSCAGFWPIARAGEQAV
LMENSRERLARYCRQLTMYRQPGEKIGAIVMNANPFTLGHRWLVEQAAQRCNWLHLFVVK
EDASFFRYRDRVALIEQGIAGIANVTLHPGSAYLISRATFPGYFLKDKGVVDDCHSQIDL
QLFRERLAPALGVTHRFVGSEPLCELTRRYNQRMRQLLEAPGDAPAIQVVELARVEKEGA
PISASRVRRLYQQRQWSSIAPLVPPGTLSFLMHLAESEHQTA
Download sequence
Identical sequences A0A0H3H339
WP_014227880.1.12607 WP_014227880.1.31371 WP_014227880.1.56093 WP_014227880.1.64237 WP_014227880.1.88526 WP_014227880.1.92269 gi|375258920|ref|YP_005018090.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]