SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|375260105|ref|YP_005019275.1| from Klebsiella oxytoca KCTC 1686

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375260105|ref|YP_005019275.1|
Domain Number 1 Region: 150-269,308-340
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.41e-21
Family Adenylyltransferase 0.0071
Further Details:      
 
Domain Number 2 Region: 40-115
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000000148
Family N-acetyl transferase, NAT 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|375260105|ref|YP_005019275.1|
Sequence length 357
Comment citrate lyase ligase [Klebsiella oxytoca KCTC 1686]
Sequence
MYTDQTLEFEKVETSNGTFRDEIILFLKNNGLGIDGDIEQFVVARCQRQLVACAGLAGNT
LKCIAVAREWRGTALGLKIIHEAELQAVQNGEHQLFLLTCPDNVRSFQGCGFYPLVTLDN
RATLMENSPVGIHRYCRQLRGQHLVTAGNIGGIVMNANPFTLGHQYLIEQAAKACDWLHV
FVVEEDLSTFSFRQRFAMVQEGSRHLPNITVHPGSKYIISRGTFPGYFLKEKQIINEVYA
AIDLLMFRRYIAPALNINQRFVGTEPFCKVTAQYNDAMHHWLEDEMTIPAASIKVNEIQR
MTDMNNLPISASAVRKLLSHEDMHTVKSMVPATTMPYLYKWLSANQSKQPDLDMVDA
Download sequence
Identical sequences A0A0H3H6V1 A0A1F2HZR6 A0A249WBX9
WP_014228728.1.10517 WP_014228728.1.12607 WP_014228728.1.12666 WP_014228728.1.17303 WP_014228728.1.18200 WP_014228728.1.18452 WP_014228728.1.2675 WP_014228728.1.27905 WP_014228728.1.31371 WP_014228728.1.36474 WP_014228728.1.37412 WP_014228728.1.56093 WP_014228728.1.63981 WP_014228728.1.64237 WP_014228728.1.6818 WP_014228728.1.92088 WP_014228728.1.92269 gi|375260105|ref|YP_005019275.1| gi|397657180|ref|YP_006497882.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]