SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|DalEC12_1|51805|e_gw1.1.299.1 from Daldinia eschscholzii EC12 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|DalEC12_1|51805|e_gw1.1.299.1
Domain Number 1 Region: 1-99
Classification Level Classification E-value
Superfamily Pre-PUA domain 3.33e-34
Family Nip7p homolog, N-terminal domain 0.0000781
Further Details:      
 
Domain Number 2 Region: 100-175
Classification Level Classification E-value
Superfamily PUA domain-like 7.46e-24
Family PUA domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|DalEC12_1|51805|e_gw1.1.299.1
Sequence length 187
Sequence
MRQLTEQETKTLFEKLANYTGSSLKNLIAPLDDSPDADRYVFRLNRDRVYYVLLSVANLA
TSISRDNLGSLGICLGKFSKTGKFRLHITALPILAEHARYKLWIKPNGEMPFLYGGNVVK
AHVGRWSDDCPSHQGIVVYNMSDTPLGFGVTARSTAEARRLDPTGIVCFRQADCGEYLRD
EDTLFAS
Download sequence
Identical sequences A0A1Y2XED6
jgi|DalEC12_1|51805|e_gw1.1.299.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]