SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|DalEC12_1|12243|fgenesh1_pg.14_#_23 from Daldinia eschscholzii EC12 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|DalEC12_1|12243|fgenesh1_pg.14_#_23
Domain Number 1 Region: 42-516
Classification Level Classification E-value
Superfamily PLP-dependent transferases 9.26e-174
Family GABA-aminotransferase-like 0.000000000203
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|DalEC12_1|12243|fgenesh1_pg.14_#_23
Sequence length 521
Sequence
MSLPALRARGASSALRSLSRWPTPVTLQYAARRTKASAAIDVQQRLLSAHLQDADPAVFD
IIEKEKNRQKHFINLIPSENFTSQAVLDALGSVMQNKYSEGYPGARYYAGNEFIDQSERL
CQQRALETFGLNEKEWGVNVQPLSGAPANLYVYSALMDTHDRLMGLDLPHGGHLSHGYQT
PTKKISAVSKYFETVPYRLNEETGLIDYEKLDELAQVYRPKIIVAGASAYGRFIDYKSIK
ETCEKVNAYLLADIAHISGMVAAKVIPSPFNFADIVTTTSHKSLRGPRGAIIFYRKGVRK
VNPKTKEEIKYNLENPINSSVFPGHQGGPHNHTITALAVALKQAQTPEFRAYQEQVLANA
QALAKRLGEAKSSGGLGYKLVSGGTDNHLVLVDLKPQGVDGARVERVLELVGVASNKNTV
PGDKSAMIPGGLRIGTPAMTTRGFSENDFVRVADIIDRSVTIAARVDKAARAAAEEKGEK
YKLKFFFDYLGTGEEDSEIVQLRAEVSDWVGTYPLPWEERP
Download sequence
Identical sequences A0A1Y2X1N7
jgi|DalEC12_1|12243|fgenesh1_pg.14_#_23

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]