SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|DalEC12_1|317362|fgenesh1_kg.10_#_293_#_Locus3392v1rpkm35.06 from Daldinia eschscholzii EC12 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|DalEC12_1|317362|fgenesh1_kg.10_#_293_#_Locus3392v1rpkm35.06
Domain Number 1 Region: 30-465
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.72e-130
Family Pyridoxal-dependent decarboxylase 0.0000000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|DalEC12_1|317362|fgenesh1_kg.10_#_293_#_Locus3392v1rpkm35.06
Sequence length 517
Sequence
MVHLAKVPANGEIGSLPEAVKKINLQLSNDDDSYTTSVYGSKFAAEDLPKHEMPEGEMPK
EIAYRMIKDELSLDGNPMLNLASFVTTYMEEEAEKLMAESFSKNFIDYEEYPQSADIQNR
CVSMIGRLFHAPTEHEEGGGAVGTSCVGSSEAIMLAVLAMKKRWKNKRIAEGKSTDRPNL
VMSSAVQVCWEKATRYFEVEEKLVYCTPERYVIDPKETVDLVDENTIGICTILGTTYTGE
YEDVKGVNDLLVERGLDIPIHVDAASGGFVAPFVVPDLEWDFRLEKVVSINVSGHKYGLV
YPGVGWVVWRDAKYLPQELVFNINYLGADQSSFTLNFSKGASQVIGQYYQLIRLGKKGYR
AIMSNLTRTADYLSEALKALGFVIMSKKSGEGLPLVAFRLPDSTTERNYDEFALAHKLRA
RGWVVPAYTMAPHTNDLKMLRVVVREDFTKNRCDSLIADIRYCQQLLEQLDKESIAKQEE
FIRKHTMNSGQAKHNHPRFRKEKHSIQGKHGKTHSIC
Download sequence
Identical sequences A0A1Y2X4M2
jgi|DalEC12_1|317362|fgenesh1_kg.10_#_293_#_Locus3392v1rpkm35.06

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]