SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|DalEC12_1|318510|fgenesh1_kg.14_#_202_#_Locus6938v5rpkm0.23_PRE from Daldinia eschscholzii EC12 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|DalEC12_1|318510|fgenesh1_kg.14_#_202_#_Locus6938v5rpkm0.23_PRE
Domain Number 1 Region: 9-521
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.17e-65
Family Pyridoxal-dependent decarboxylase 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|DalEC12_1|318510|fgenesh1_kg.14_#_202_#_Locus6938v5rpkm0.23_PRE
Sequence length 526
Sequence
MDSETFLSTSYARIRAVAGVPPGTSARTLPSPSTLSQARSTLPSDPATALLSGRGPEATL
SHLTSDIAPALAGHNRSGRYYGFVTGSTLPVAEAADNLVSALDNSLQVHLPGQSVATEVE
DAALRLLLKVLDLDRGDENSRWEGRTFTTGATASNVLGLACGREAVVTARLPPGSANEGG
VGELGLLGACAAAGVKEIQVLTSMGHSSLSKAASVVGLGRRAVKELRYSEAEPWRLDLDA
VERELQREGVASIIAVSAGEVNTGRFATTGFGDMRRLRDLTDKYKAWIHVDGAFGIFARS
LPATSEFARLREFTAGLELADSITVDGHKLLNVPYDTGIFFTRTSTIPQAVFQNPNAVYL
STPTPSSGPTIPSPLNIGLENSRRFRALPVYAVLLSEGAAGIADMLARMVRLARGIAGAI
TRDEKLKHDYELLATSSSTGDEKDNDDNNENTHIVVLFRARDEGLNEKLVEKIQVSGEWY
VSGTKWEGRPACRIAVSSWRVKVDEDLGFVKDRLAGIAKEWKEGSK
Download sequence
Identical sequences A0A1Y2WZK1
jgi|DalEC12_1|318510|fgenesh1_kg.14_#_202_#_Locus6938v5rpkm0.23_PRE

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]