SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386353150|ref|YP_006051397.1| from Streptomyces cattleya NRRL 8057 = DSM 46488

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386353150|ref|YP_006051397.1|
Domain Number 1 Region: 25-298
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 2.35e-59
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0000397
Further Details:      
 
Domain Number 2 Region: 245-406
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0000000000000167
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386353150|ref|YP_006051397.1|
Sequence length 543
Comment ubiquinol-cytochrome C reductase cytochrome subunit B [Streptomyces cattleya NRRL 8057 = DSM 46488]
Sequence
MLFRKTKARMEARARQSAMTGYVALDRRLPVSELAKELLRKAFPDHWTFLLGEIALYGFV
ILVLTGTYLTLFFDPGMTEHVYQGAYAPLRGLRVTDAYSSTLDISFDVRGGLLIRQIHHW
AALVFVAAIGVHMLRIFFTGAFRRPREVNWFVGVTLFLLALLEGFCGYSLPDDLLSGTGL
RTANTIVQSIPVVGTYLSFFFWRGPFPGHALIPRLYIVHVLFVPGLLIALIAVHLIMVVY
LKHTQWAERGKTNRNVVGQPMVPQFTAKSTGFFFMIFGALTVLGAVAQINPIWNYGPFRA
DQVATDAQPDWYVGFLEGALRIMPPWENAPGGHTLMWNVFLPAVVLPALLFLVMYLYPFF
ERWVTGDLMEHHLCDRPRDRPTRTGLGVAAIVFYAVLLLAGGNDVTAFAFRVSVNTLTWI
YRVAVVVGPVLAFWVTKRICLALQAHDRELLTEGVETGKVSQDVSGGIGESSRPIPAEHR
YRLLVRDIPRPLPVPGPDAARRHRLRAALSAWYYRDRVEMPATTEQRLQVTGRTADPVAG
PEE
Download sequence
Identical sequences F8JM33
WP_014150944.1.28582 WP_014150944.1.70206 gi|386353150|ref|YP_006051397.1| gi|357407858|ref|YP_004919781.1|NC_016113 gi|386353150|ref|YP_006051397.1|NC_017585 gi|357407858|ref|YP_004919781.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]