SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386353320|ref|YP_006051567.1| from Streptomyces cattleya NRRL 8057 = DSM 46488

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386353320|ref|YP_006051567.1|
Domain Number 1 Region: 27-108
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.44e-19
Family LysR-like transcriptional regulators 0.005
Further Details:      
 
Domain Number 2 Region: 127-321
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.59e-19
Family Phosphate binding protein-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386353320|ref|YP_006051567.1|
Sequence length 342
Comment LysR family transcriptional regulator [Streptomyces cattleya NRRL 8057 = DSM 46488]
Sequence
MTDGEIKQPTSHESTTVGCAITLAGVDLDAVRTFVAAADAGRFQDAAAGLSITQQAVSKR
IATLEKTLGVRLFTRTARGAKLTIDGQAFLPHARDLLRAEERAAASVRPGSRPLRVDVIG
RRLAPATLLSDFRRAHPGTELDVVTLFDADAAVDAIRSGVIDASFRAVTMPGRALPDDIE
AVRVYGEPIQLLTGPAHELAAAHAVTPAGLVGHRIWMPGLVPGTEWGAYYDALAAAFGLT
IEITGPDFGTEPVLETVAGSPELATFVGERTHLVWPTDHGLRRITVRDPTPVYPHSLVWH
RDNPHPVLAALRDHLRSARTDHDDTGTWAPAWAWSAEPRRGR
Download sequence
Identical sequences G8XG84
gi|386353320|ref|YP_006051567.1|NC_017585 gi|386353320|ref|YP_006051567.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]