SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386355525|ref|YP_006053771.1| from Streptomyces cattleya NRRL 8057 = DSM 46488

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386355525|ref|YP_006053771.1|
Domain Number 1 Region: 50-378,449-495
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.48e-80
Family Type II chitinase 0.0000000779
Further Details:      
 
Domain Number 2 Region: 527-578
Classification Level Classification E-value
Superfamily Carbohydrate binding domain 2.22e-16
Family Carbohydrate binding domain 0.0027
Further Details:      
 
Domain Number 3 Region: 380-448
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.000000327
Family Chitinase insertion domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386355525|ref|YP_006053771.1|
Sequence length 578
Comment glycosyl hydrolase family chitinase [Streptomyces cattleya NRRL 8057 = DSM 46488]
Sequence
MHVFRKGRQANRPLTAALSVLALAAGAVGALAGAASAGAAPAPAAAAAPAAASSGGVKIA
YYDQWSVYGNAFYPKDLDTRGIAGKLDILNYSFENIDPSNLTCFEATKASDASNESDPNA
GDGAGDAFADYQKSFGADISVNGQADTWNQPIVGNFNQLKELKAKYPKLRIVASIGGWTY
SKYFSDVAASDASRKKFVSSCIDMFIKGNLPVQGGYGGPGSAAGIFDGFDIDWEYPGSPG
GHVGNHYSTADKANYTALLAEFRSELDAYGAAGNRKMLLTAAMPAGQDKIAQIQTDKVGQ
YLDYANVMTYDMHGAWDATGPTNHQDPTYSSPDDPSKAVDPGTEKYSTDNAVKAWTTGDA
AYGIAGGFPAAKLTMGYPLYYRGWTGVPAGSNHGLYQSATGPASARSLSQTAGTAYYKEL
TGIVDNPADTFYDPKTGSNWFYNGTEFWTGLGAQSIQAKADYAHCHGLGGSMMYSLLDLD
TSATLFNKIVDATNGSAASCSSTPTPTPTPTPTPTPTPTPTPTPTPGTCTAAAWDKSAVY
TAGNTVSYNGHTWQAKWWTQGEVPGASQWGAWQDLGAC
Download sequence
Identical sequences F8JTA1
WP_014142642.1.28582 WP_014142642.1.70206 gi|386355525|ref|YP_006053771.1| gi|357399486|ref|YP_004911411.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]