SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386356044|ref|YP_006054290.1| from Streptomyces cattleya NRRL 8057 = DSM 46488

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386356044|ref|YP_006054290.1|
Domain Number 1 Region: 15-147
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.04e-29
Family MarR-like transcriptional regulators 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386356044|ref|YP_006054290.1|
Sequence length 152
Comment MarR family transcriptional regulator [Streptomyces cattleya NRRL 8057 = DSM 46488]
Sequence
MTELSEDDLAAVNSLRSAILRLSRRMRRGVPHVVGQGAPDESLSFTEMSVLGLLVRCGSA
TPGELARKEHVQPPSMTRIVAMLEAKGLVRREPHPEDRRQVMVSSTEAAEAMLAESRRRR
NAWLAGLAEGLTDEEWAVLRDAAPTLEKLAHL
Download sequence
Identical sequences F8JZ92
gi|386356044|ref|YP_006054290.1| WP_014143159.1.28582 WP_014143159.1.70206 gi|357400004|ref|YP_004911929.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]