SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386358516|ref|YP_006056762.1| from Streptomyces cattleya NRRL 8057 = DSM 46488

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386358516|ref|YP_006056762.1|
Domain Number 1 Region: 35-459
Classification Level Classification E-value
Superfamily Seven-hairpin glycosidases 1.83e-109
Family Class I alpha-1;2-mannosidase, catalytic domain 0.00000236
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386358516|ref|YP_006056762.1|
Sequence length 465
Comment hypothetical protein SCATT_48690 [Streptomyces cattleya NRRL 8057 = DSM 46488]
Sequence
MAAAALTPWPASAADRTADASDPGPARTTALPPDHRVAAEIRSEFLHGWRGYTQVAWGYD
EVRPVSGGRNDFFAPGRTFGLSIVEALDTLYVMGEDAEVARGCDWIEAHFDPAQDADVHV
FEAVIRLVGGLLAGYLATGRKRLLDRCREFTDRLLPAFASPTGIPYTHVNLRTGAVSGSS
VPLAEVGTNVMEFGLLTRLTGDRRYLDASMRAYRAAMARRTSLGLLGTSIDAETGRWTDP
ASVAPNPPVDSFYEYLWGGWALLGDRRLRDWYRSLTSAILKHQADTGTGHLWFRQVDPAT
GRQLGTSQSELASFYAGLLGKGGDPRHARAYYESWTAVLDRYPVLPEGIDYRTLAATDTG
NQLRPEYVNSSFDLWRLTRDPYYKRTAYRYFTGMRDHLRVPGGYTIAADVTASPMRLGDL
TPAYWFAENPKYLYLIFADSPRFDYRTGVLSTEGKILKGLRRPGR
Download sequence
Identical sequences G8WXU0
gi|386358516|ref|YP_006056762.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]