SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386359164|ref|YP_006057410.1| from Streptomyces cattleya NRRL 8057 = DSM 46488

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|386359164|ref|YP_006057410.1|
Domain Number - Region: 130-196
Classification Level Classification E-value
Superfamily Prim-pol domain 0.00061
Family PriA-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386359164|ref|YP_006057410.1|
Sequence length 335
Comment hypothetical protein SCATT_55170 [Streptomyces cattleya NRRL 8057 = DSM 46488]
Sequence
MAEAVELRAGERTVRVSHPDKVYFPERGLTKLDVVRYYLAVGDGVLRALRDRPTMLERYP
DGVGGESFFQKRAPKNLPEWIPTGRIAFPSGRYADEICPTETAAVLWAANLGCLTFHPWP
VRRADVDHPDELRIDLDPQPGTGFPEARRAARELRPLLTELGLTGWPKTSGGRGLHVFVP
IEPRWTFTQVRRAAIAVARELERRMPEQVTTAWWKEERGAKIFVDYNQTARDRTIASAYS
VRPRPHAPVSAPLRWEEVDDADPRDFDVVTMAARFAELGDVHAPMADRPCSLLSALELAD
RDERDHGLGDLPYPPEHPKMPGEPARVQPSRAKRR
Download sequence
Identical sequences F8JRK1
WP_014146216.1.28582 WP_014146216.1.70206 gi|357403080|ref|YP_004915005.1| gi|386359164|ref|YP_006057410.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]