SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386359284|ref|YP_006057530.1| from Streptomyces cattleya NRRL 8057 = DSM 46488

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386359284|ref|YP_006057530.1|
Domain Number 1 Region: 50-379,451-494
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.43e-77
Family Type II chitinase 0.000000229
Further Details:      
 
Domain Number 2 Region: 570-700
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000164
Family CBM22 0.078
Further Details:      
 
Domain Number 3 Region: 381-448
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.000068
Family Chitinase insertion domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386359284|ref|YP_006057530.1|
Sequence length 702
Comment glycosyl hydrolase family chitinase [Streptomyces cattleya NRRL 8057 = DSM 46488]
Sequence
MQPPPTPFRRPALSALAVLALVLGALAAVLNGMGSAHASTAHDQRTTVPTVTTGGKKVAY
YDQWSIYQNAFYPKALDTEGIAGKLDYLVYDFENIDPTNLTCFETTKATDPDPGGESDPN
AGDGAEDQFADYQKTFDGGISVDGTSDTWNQPIAGNFHQLQELKKKYPNLKVLLSIGGWT
YSKYFSDAAASDASRKKFVSSCVDMFIKGNIPASGGYGGPGTAAGIFDGIDIDWEYPASS
GGHTGNHYSAADTANFTALLAEFRSELDAQGATDGKHYALAAALPGGQDKVAKVQTDQIG
KYLDFGDVMTYDMHGAWDTTGPTNFQDPLYPSANDPSNPIPPGSEKYVIDSVVKAYTQGD
SAYGIPGGFPASKVNLGIPFYYRGWTGVPAGSNHGLYQSATGPSAGHALSGNVPGVAMYK
ELTGVVDNPSDTFWDPTTQSAWFYDGTNFYGGESDRSIQARADYIHCNGLAGAMMFSLYD
LDPQTKLFNDVVDDVNGTAANCSGGGTTTGGTSTGGTTTGGTTTGGTTTGGTTTGGTTTG
GTTTGGTTTGGTTTGGTTTGGTTGGGDGGTGAVVNGDFESGSLSPWNCTNGSGTVVSSPV
HSGGHALQANATSSDDAQCSQTITVQPGHTYTLSGWVQGSYVYLGVTGTGTSDASTWTPG
TGGSYAKLSTSFTTGSSTTSVTVWVHGWYGQGTYYADDISTS
Download sequence
Identical sequences F8JSZ0
gi|386359284|ref|YP_006057530.1| WP_014146341.1.28582 WP_014146341.1.70206 gi|357403205|ref|YP_004915130.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]