SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386353196|ref|YP_006051443.1| from Streptomyces cattleya NRRL 8057 = DSM 46488

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386353196|ref|YP_006051443.1|
Domain Number 1 Region: 76-232
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 3.31e-33
Family D-ribose-5-phosphate isomerase (RpiA), catalytic domain 0.072
Further Details:      
 
Domain Number 2 Region: 5-58
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000304
Family TrmB-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386353196|ref|YP_006051443.1|
Sequence length 252
Comment transcriptional regulator, DeoR family [Streptomyces cattleya NRRL 8057 = DSM 46488]
Sequence
MLKADRLARLLEHVATEGSANVHELADLLQVSSATVRRDLHVLHEQGLVRRTHGGAVTGA
LSLELPVRHRLGTRQAEKSRIAAKAAALVPDGAVVGMTGGTTVTEVARALSDRTGITVVT
NAVNIAADLVMRRDIHLVVIGGNARSQSYELVGPIAERTLANYHIDISFIGVDGLSPGQG
CTTHDEMEAHTDRAFLSNSDRTVVVADSSKIGKATFARICPLNEIDTLVTDDGADPAQLE
ALRTMGIDVIAT
Download sequence
Identical sequences G8XFM9
gi|386353196|ref|YP_006051443.1|NC_017585 gi|386353196|ref|YP_006051443.1| WP_014627027.1.28582 WP_014627027.1.70206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]