SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386353650|ref|YP_006051896.1| from Streptomyces cattleya NRRL 8057 = DSM 46488

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386353650|ref|YP_006051896.1|
Domain Number 1 Region: 14-155
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000732
Family MarR-like transcriptional regulators 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386353650|ref|YP_006051896.1|
Sequence length 160
Comment hypothetical protein SCATT_00030 [Streptomyces cattleya NRRL 8057 = DSM 46488]
Sequence
MIRTTIDQAPADPTATDDMLTTQPIGYWSGLAHTAVTRQLRDAMAKIDITQPQYWVLNRV
KYAPAAPSRTEVVDQLTPLADGQHEIPRVLGQLLHRGWLRTDADQRLHLTDAGETARVHV
RELVTELRALVHEGISDEEYVAALKVLRRMIANVEGSRNA
Download sequence
Identical sequences G8WVS9
gi|386353650|ref|YP_006051896.1| WP_014627186.1.28582 WP_014627186.1.70206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]