SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386354491|ref|YP_006052737.1| from Streptomyces cattleya NRRL 8057 = DSM 46488

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386354491|ref|YP_006052737.1|
Domain Number 1 Region: 11-102
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000799
Family ArsR-like transcriptional regulators 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386354491|ref|YP_006052737.1|
Sequence length 120
Comment transcription regulator ArsR [Streptomyces cattleya NRRL 8057 = DSM 46488]
Sequence
MPSSPPPAGRTLPHPGRDEIRLEAVLHALSDPMRLRVVRALAAAEAEMACSEVELTVSKS
TSTHHFRVLREAGVICQCYRGTAKMNGLRRDDLEALFPGLLDAVLAAAERQASPAAAGTR
Download sequence
Identical sequences F8JW47
gi|357398460|ref|YP_004910385.1| gi|386354491|ref|YP_006052737.1| WP_014141616.1.28582 WP_014141616.1.70206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]