SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386356717|ref|YP_006054963.1| from Streptomyces cattleya NRRL 8057 = DSM 46488

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386356717|ref|YP_006054963.1|
Domain Number 1 Region: 11-112
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.77e-28
Family HxlR-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386356717|ref|YP_006054963.1|
Sequence length 120
Comment transcriptional regulator [Streptomyces cattleya NRRL 8057 = DSM 46488]
Sequence
MRPDPNECQSIDHGITRVFTLLGKRWTGVIIAVLMANGRMYFAELRRGIPGISERMLSDR
LTELAAAGLLTREVDEGPPLRVGYRLTPAGDALAPAMNELAEWAATHMPEAPPCPRGPAA
Download sequence
Identical sequences F8JSC6
WP_014143814.1.28582 WP_014143814.1.70206 gi|357400663|ref|YP_004912588.1| gi|386356717|ref|YP_006054963.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]