SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|563712255|ref|YP_008873033.1| from Candidatus Saccharibacteria bacterium RAAC3_TM7_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|563712255|ref|YP_008873033.1|
Domain Number 1 Region: 231-425
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.39e-57
Family B3/B4 domain of PheRS, PheT 0.0000144
Further Details:      
 
Domain Number 2 Region: 494-716
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.58e-27
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0014
Further Details:      
 
Domain Number 3 Region: 45-219
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.18e-26
Family Myf domain 0.0057
Further Details:      
 
Domain Number 4 Region: 434-502
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.000000000000192
Family Domains B1 and B5 of PheRS-beta, PheT 0.003
Further Details:      
 
Domain Number 5 Region: 723-821
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 0.0000000000034
Family Anticodon-binding domain of PheRS 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|563712255|ref|YP_008873033.1|
Sequence length 823
Comment Phenylalanine-tRNA ligase beta subunit [Candidatus Saccharibacteria bacterium RAAC3_TM7_1]
Sequence
MRVSLNQIKQFIDFELPPVDELVKKINSQLGKVEETINLGERYEKAVIVKVVSCEDHPNA
DRLHVCRVDDGGVVQDVERDENGHVQVVCGAPNVHTDMYAVWLPPSSTVPASFAEKEPFV
LEKREIRGVMSNGMLAAGDELAINSDHDGIIEIDPDEWKPSDEAVKPGVSFAKLYGLDDH
VIDIENKMFTHRPDLFGQLGVAREIAGIHHQAFTSPDWYAGAPEFSSASGLEFEVSNNAD
GNVPRLMTVAIKDVVVKPSPLWLQCALMRLGAKPINNIVDVTNYIMLLTAQPVHAYDYDK
LRGHKLVARMALPGEEVTLLNHKQYALDVTDIVIADAEGPIGLAGIMGGGDSEVSDETKN
VVLEVANFDMYTIRKSSMHHGLFTDASNRFNKGQSPLQNSYVMNLLMTSLRDVAGGEQAS
DVFDSGTDRVNEPIAGSVDFINQRLGLGLSASEMRQLLENVEVKIGLENGITVEPPFWRT
DIRLAEDVVEEVGRLYGFDKLPLELPLRTMAPTVKDAILTMKTKVRESLSRAGANEVLTY
SFVHERVLEQSGQDSAQAYRLSNALSPDLQYYRLSLTPSLLDKIHMNIKAGHDEFALFEF
GKAHRKDDMDDEGLPREYERLAFVYAAKKSSETAYYKAKHYLETLAPEVSYIPLRDFSIE
YPIFDQLAQPFEPGRAAVVMSGEHFVGVIGEYKASVRRAFKLPETTAGFEIFQSFLVKQK
PATYQPLSRFPSVTQDISLRIPVATTYAAVFELARQATNEAASNLRFDISPLALYQPEGS
DVKTVTLRFKVTSDNRTLKEEEVSSVVAAVAAAGKDKLGAERI
Download sequence
Identical sequences V5RWF0
gi|563712255|ref|YP_008873033.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]