SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000005896 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000005896
Domain Number - Region: 206-255
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00176
Family Merozoite surface protein 1 (MSP-1) 0.044
Further Details:      
 
Domain Number - Region: 259-303
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0821
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000005896   Gene: ENSSSCG00000005502   Transcript: ENSSSCT00000006050
Sequence length 358
Comment pep:known chromosome:Sscrofa10.2:1:288523735:288860125:-1 gene:ENSSSCG00000005502 transcript:ENSSSCT00000006050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVCGSQMSCPLTVKVTLHVPEHFIADGSSFVVSEGSYLDISDWLNPAKLSLYYQINATSP
WVRDLCGQRTTDACEQLCDPETGECSCHEGYAPDPVHRHLCVRSDWGQSEGPWPYTTLER
GYDLVTGEQAPEKILRSTFSLGQGLWLPVSKSFVVPPVELSINPLASCKTDVLVTEDPAD
VREEAMLSTYFETINDLLSSFGPVRDCSRNNGGCTRNFKCVSDRQVDSSGCVCPEELKPM
KDGSGCYDHSKGIDCSDGFNGGCEQLCLQQTLPLPYDATSSTIFMFCGCVEEYKLAPDGK
SCLMLSDVCEGPKCLKADSKFNDTLFGEMLHGYNNRTQHVNQGQVFQMTFRYGADTSL
Download sequence
Identical sequences ENSSSCP00000005896 ENSSSCP00000005896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]