SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000009730 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000009730
Domain Number 1 Region: 10-273
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-91
Family Protein kinases, catalytic subunit 0.00000207
Further Details:      
 
Domain Number 2 Region: 340-470
Classification Level Classification E-value
Superfamily NTF2-like 1.45e-43
Family Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A 0.00000067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000009730   Gene: ENSSSCG00000009123   Transcript: ENSSSCT00000009990
Sequence length 499
Comment pep:known chromosome:Sscrofa10.2:8:116955005:117260328:1 gene:ENSSSCG00000009123 transcript:ENSSSCT00000009990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDT
VTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKL
KGAILTTMLATRNFSAAKSLLKKPDGVKESTESSNTTIEDEDVKARKQEIIKVTEQLIEA
INNGDFEAYTKICDPGLTAFEPEALGNLVEGMDFHRFYFENALSKSNKPIHTIILNPHVH
LVGDDAACIAYIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIKPS
CIPNGKENFSGSTSLWQNI
Download sequence
Identical sequences G1LRM2 M3WNF0 Q95266
NP_999546.1.46622 XP_007088245.1.5354 XP_008687673.1.72690 XP_011227777.1.58354 XP_012909416.1.14098 XP_014930292.1.86478 XP_019273729.1.44245 XP_019273738.1.44245 XP_019684587.1.62641 XP_021540196.1.83697 ENSSSCP00000009730 ENSSSCP00000009730 ENSAMEP00000009708 ENSFCAP00000015292 9823.ENSSSCP00000009730 ENSAMEP00000009708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]