SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000010994 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000010994
Domain Number 1 Region: 10-299
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.16e-90
Family Protein kinases, catalytic subunit 0.00000181
Further Details:      
 
Domain Number 2 Region: 401-531
Classification Level Classification E-value
Superfamily NTF2-like 2.85e-45
Family Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A 0.000000226
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000010994   Gene: ENSSSCG00000010311   Transcript: ENSSSCT00000011286
Sequence length 539
Comment pep:known chromosome:Sscrofa10.2:14:82663521:82719243:-1 gene:ENSSSCG00000010311 transcript:ENSSSCT00000011286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTATCTRFTDDYQLFEELGKGAFSVVRRCVKKTSTQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQI
LESVNHIHQHDIVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARRKL
KGAILTTMLVSRNFSVGRQSSAPASPAASAAGLAGQAAKSLLNKKSDGGVKPQSNNKNSL
VSPAQEPAPLQTAMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKVRKQEIIKITEQLIE
AINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHKFYFENLLSKNSKPIHTTILNPHV
HVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWLNVHYHCSGAPAAPLQ
Download sequence
Identical sequences A0A1S2ZJQ9 A0A2I3N097 A0A2J8U5J6 A0A2K5F2W6 A0A2K5NKA5 K7C9T1 Q7JFN2 Q95265 U3CZS8
NP_001191421.1.87134 NP_001191421.1.92137 NP_999358.1.46622 XP_003363535.1.31192 XP_004407084.1.74151 XP_004583548.1.84141 XP_004624075.1.9945 XP_004769448.1.14098 XP_005367704.1.66349 XP_006518559.1.92730 XP_007520399.1.11023 XP_007961173.1.81039 XP_008768716.1.100692 XP_011940927.1.92194 XP_011974366.1.54773 XP_016774124.1.37143 XP_017897861.1.57651 XP_019300140.1.44245 XP_021059303.1.100879 XP_021498636.1.76796 XP_021555520.1.83697 XP_863772.1.84170 gi|325197141|ref|NP_001191421.1| ENSSSCP00000010994 9615.ENSCAFP00000022365 ENSSSCP00000010993 ENSP00000378243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]