SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000013379 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000013379
Domain Number 1 Region: 5-141
Classification Level Classification E-value
Superfamily NTF2-like 5.15e-45
Family NTF2-like 0.00000149
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000013379   Gene: ENSSSCG00000012581   Transcript: ENSSSCT00000013757
Sequence length 144
Comment pep:known chromosome:Sscrofa10.2:X:105300452:105304763:1 gene:ENSSSCG00000012581 transcript:ENSSSCT00000013757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMSVDFKTYVDQACRAAEEFVNIYYETMDKRRRALTRLYLDKATLIWNGNVVTGLEALT
NFFEMLPSSEFQVNMLDCQPVHDPEQATQAQTTVLVVTSGTVKFDGNKQHYFNQNFLLTA
QSTPNNTVWKIASDCFRFQDWASS
Download sequence
Identical sequences ENSSSCP00000013379 ENSSSCP00000013379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]