SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000015374 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000015374
Domain Number 1 Region: 3-203
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.16e-68
Family Protein kinases, catalytic subunit 0.00000483
Further Details:      
 
Domain Number 2 Region: 341-471
Classification Level Classification E-value
Superfamily NTF2-like 4.17e-43
Family Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A 0.000000224
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000015374   Gene: ENSSSCG00000014443   Transcript: ENSSSCT00000015790
Sequence length 479
Comment pep:known chromosome:Sscrofa10.2:2:158143674:158174737:1 gene:ENSSSCG00000014443 transcript:ENSSSCT00000015790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPAVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQM
GVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYLSPEVLRKDP
YGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLIN
KMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLKGAILTTMLA
TRNFSGRRRDEPCAGARCGAAGARAGPSGRSFLGETRAGGYGAEATDAGGRWPSLLSPRQ
LRPRPQTSELSDQGPIPCPEVAGGKGSTEESSESTNTTIEDEDTKVRKQEIIKVTEQLIE
AISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKPVHTTILNPHI
HLMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHRSGAPSVLPQ
Download sequence
Identical sequences ENSSSCP00000015374 ENSSSCP00000015374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]