SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017044 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000017044
Domain Number - Region: 131-183
Classification Level Classification E-value
Superfamily NTF2-like 0.00745
Family TIM44-like 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017044   Gene: ENSSSCG00000016088   Transcript: ENSSSCT00000017516
Sequence length 288
Comment pep:known chromosome:Sscrofa10.2:15:114852786:114865265:1 gene:ENSSSCG00000016088 transcript:ENSSSCT00000017516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALAVRLLSRLLLFRPLPGWAARLQSPGSTEVRPPWPGFCCFCRRRLGSGTTPFPRVSWA
LALPARGPGRPLLSPRELPATLPAFSSCSRRTYSTEDQPQQRQKTKMIILGFPNPINWVR
TRIYSFLIWAYFDQEFSIAEFSEGAKQAFSHVSKLLSQCKFDLLEELVAKEALHVLKEKV
TSLPDNHKHALAADIDEIVYTSTGDISIYYDEKGRKFVNILMCFWYLTSANIPSETISGA
SVFQVKLGDQNMETKQLLSASYEFQREFTQGVKPDWTIARIEHPKLLE
Download sequence
Identical sequences A0A286ZYM2
XP_003133619.1.46622 9823.ENSSSCP00000017044 ENSSSCP00000017044 ENSSSCP00000017044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]