SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017738 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017738
Domain Number 1 Region: 115-243
Classification Level Classification E-value
Superfamily NTF2-like 4.07e-46
Family Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A 0.000000488
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017738   Gene: ENSSSCG00000016748   Transcript: ENSSSCT00000018230
Sequence length 251
Comment pep:known_by_projection chromosome:Sscrofa10.2:18:55837904:55849658:1 gene:ENSSSCG00000016748 transcript:ENSSSCT00000018230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVSFNAAAKSLLNKKADGVKPQTNSTKNSAAATSPKGTLPPAALEPQTTVIHNPVDGIK
ESSDSTHTTIEDEDTKEMSLRGPNGALPQASSSGLSWARLPFLGGHPLPQQLPVPSPARK
QEIIKITEQLIEAVNNGDFEAYAKICDPGLTSFEPEALGNLVEGMDFHRFYFENLLAKNS
KPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSKETRVWHRRDGKWQNVHF
HCSGAPVAPLQ
Download sequence
Identical sequences 9823.ENSSSCP00000017738 ENSSSCP00000017738 ENSSSCP00000017738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]