SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000018094 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000018094
Domain Number 1 Region: 4-132
Classification Level Classification E-value
Superfamily NTF2-like 7.5e-35
Family NTF2-like 0.0033
Further Details:      
 
Domain Number 2 Region: 334-441
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.36e-18
Family Canonical RBD 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000018094   Gene: ENSSSCG00000017079   Transcript: ENSSSCT00000018595
Sequence length 464
Comment pep:known_by_projection chromosome:Sscrofa10.2:16:77426673:77443279:-1 gene:ENSSSCG00000017079 transcript:ENSSSCT00000018595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLESPSXLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHGGLDSNGKPADAVYGQKEI
HRKVMAQNFTNCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPEGSVA
NKFYVHNDIFRYQDEVFGGFVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQTVSND
LEEHLEEPVAEPEPDPEPEPEQEPVSEVQEEKSEPVLEEAAPEDVQKSSSPAPADIAQTV
QEDLRTFSWASVTSKNLPPSGAVPVTGIPPHVVKVPASQPRPETKPESQIPPQRPQRDQR
VREQRINVPPQRGPRPVREAGEQGDVEPRRIVRHPDSHQLFIGNLPHEVDKLELKDFFQN
YGNVVELRINSGGKLPNFGFVVFDDSEPVQKVLSNRPIMFRGEVRLNVEEKKTRAAREGD
RRDNRLRGPGGPRGGLGGGMRGPPRGGMVQKPGFGVGRGLTPRQ
Download sequence
Identical sequences ENSSSCP00000018094 ENSSSCP00000018094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]