SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000018098 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000018098
Domain Number 1 Region: 150-297
Classification Level Classification E-value
Superfamily EF-hand 1.95e-48
Family Osteonectin 0.0000000912
Further Details:      
 
Domain Number 2 Region: 92-147
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000139
Family Ovomucoid domain III-like 0.0000618
Further Details:      
 
Domain Number 3 Region: 67-91
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000183
Family Follistatin (FS) module N-terminal domain, FS-N 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000018098   Gene: ENSSSCG00000017083   Transcript: ENSSSCT00000018599
Sequence length 299
Comment pep:known scaffold:Sscrofa10.2:GL894053.2:48146:60885:1 gene:ENSSSCG00000017083 transcript:ENSSSCT00000018599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAWIFFLLCLAGKALAAPQQEALPDETEVVEETVAEVPVGANPVQVEVGEFDDGAEEAE
EEVVAENPCQNHHCKHGKVCELDENNSPMCVCQDPTSCPAPXSKKEEVCSNDNKTFDSSC
HFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDE
NNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPI
DGYLTHTEXPLRAPLIPMEHCTTRFFQTCDLDNDKYIALDEWAGCFGIKEQDIDKDLVI
Download sequence
Identical sequences ENSSSCP00000018098 ENSSSCP00000018098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]