SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000019803 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000019803
Domain Number 1 Region: 3-127
Classification Level Classification E-value
Superfamily NTF2-like 1.28e-39
Family NTF2-like 0.00000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000019803   Gene: ENSSSCG00000025301   Transcript: ENSSSCT00000025288
Sequence length 128
Comment pep:known_by_projection scaffold:Sscrofa10.2:GL896204.1:17164:21712:1 gene:ENSSSCG00000025301 transcript:ENSSSCT00000025288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDKPIWEQIGSSFIQHYYFFSFLLSELELCDYRIDASCLTWEGQQFQGKTAIVEKLSSL
PFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMF
RLALHNFG
Download sequence
Identical sequences ENSSSCP00000019803 ENSSSCP00000019803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]