SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020822 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000020822
Domain Number - Region: 107-150
Classification Level Classification E-value
Superfamily NTF2-like 0.0438
Family TIM44-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020822   Gene: ENSSSCG00000025457   Transcript: ENSSSCT00000024338
Sequence length 169
Comment pep:known scaffold:Sscrofa10.2:GL896349.1:14082:17934:1 gene:ENSSSCG00000025457 transcript:ENSSSCT00000024338 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPVTRGLSCLPRVLGWWSRQPVLVTQSTAVVPVRTKKRFTPPTYQPKYKSEKEFVEHA
RKAGLVIPHERLERPIHLACTAGIFDAYVPPEGDARISSLSKEGLAQRAERLKKNVASQL
SIRKIRESDPNFKIKDFPEKAKDIFIEAHLCLNKYVNSLFYTGYVLSSC
Download sequence
Identical sequences ENSSSCP00000020822 ENSSSCP00000020822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]