SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020911 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000020911
Domain Number - Region: 126-178
Classification Level Classification E-value
Superfamily NTF2-like 0.00482
Family TIM44-like 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020911   Gene: ENSSSCG00000024854   Transcript: ENSSSCT00000029988
Sequence length 209
Comment pep:known scaffold:Sscrofa10.2:JH118883.1:217927:223799:1 gene:ENSSSCG00000024854 transcript:ENSSSCT00000029988 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALAVRLLSRLLLFRPLQSPGSTEVRPPWPGFCCFCRRRLGSGTTPFPRVSWALALPARG
PGRPLLSPRELPATLPAHSSCSXSRRTYSTEDQPQQRQKTKMIILGFPNPINWVRTRIYS
FLIWAYFDQEFSIAEFSEGAKQAFSHVSKLLSQCKFDLLEELVAKEALHVLKEKVTSLPD
NHKHALAADIDEIVYTSTGDISIYYDEKG
Download sequence
Identical sequences ENSSSCP00000020911 ENSSSCP00000020911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]