SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023219 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023219
Domain Number 1 Region: 8-68
Classification Level Classification E-value
Superfamily NTF2-like 0.00000000000745
Family TIM44-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023219   Gene: ENSSSCG00000023263   Transcript: ENSSSCT00000023954
Sequence length 104
Comment pep:known scaffold:Sscrofa10.2:GL896494.1:18835:20687:-1 gene:ENSSSCG00000023263 transcript:ENSSSCT00000023954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQGNIYGQVTVRMHTRQTLAIYDRFGRLMYGQEDVPRDVLEYVVFEKHLVDPYGSWRMH
GKIIPPWAPPKQPILKTVMIPGPQLKPWEEFEEPQGEVHKPQPA
Download sequence
Identical sequences ENSSSCP00000023219 ENSSSCP00000023219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]