SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000024537 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000024537
Domain Number 1 Region: 3-126
Classification Level Classification E-value
Superfamily NTF2-like 6.71e-50
Family NTF2-like 0.000000322
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000024537   Gene: ENSSSCG00000030295   Transcript: ENSSSCT00000027161
Sequence length 127
Comment pep:known chromosome:Sscrofa10.2:6:25643317:25663655:-1 gene:ENSSSCG00000030295 transcript:ENSSSCT00000027161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKTAIVEKLSSLP
FQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFR
LALHNFG
Download sequence
Identical sequences F1S2K3
XP_003126970.2.46622 9823.ENSSSCP00000002989 ENSSSCP00000024537 ENSSSCP00000024537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]