SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000025799 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000025799
Domain Number 1 Region: 371-555
Classification Level Classification E-value
Superfamily NTF2-like 3.29e-65
Family NTF2-like 0.0000000179
Further Details:      
 
Domain Number 2 Region: 110-201
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.9e-36
Family Non-canonical RBD domain 0.00000538
Further Details:      
 
Domain Number 3 Region: 205-360
Classification Level Classification E-value
Superfamily L domain-like 1.09e-32
Family mRNA export factor tap 0.000000178
Further Details:      
 
Domain Number 4 Region: 552-620
Classification Level Classification E-value
Superfamily UBA-like 6.12e-26
Family TAP-C domain-like 0.0000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000025799   Gene: ENSSSCG00000022866   Transcript: ENSSSCT00000029108
Sequence length 620
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:8315196:8327226:1 gene:ENSSSCG00000022866 transcript:ENSSSCT00000029108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADEGKSYNEHDDRVSFPQRRKKGRGPFRWKCGEGNRRSARGGSSIRSSRLEEDDRDVAV
SDAQDVPRLRYNPYAPRPNRRGDGWHERSRIHVTVPLRRDRVPPERGGAGTSQDGTSKNW
FKITIPYGRKYDKSWLLGMIQSKCSVPFTPIEFHYENTRAQFFVEDASTASALKAVNYKI
LDRENRRISIIINSSPPPHTVQNELKPEQVEQLKLIMSKRYDGSQQALDLKGLRTDPDLV
AQNIDVVLNRRSCMAAALRIIEENIPELLSLNLSNNKLYRLDDLSNIVQKAPNLKILNLS
GNELKSERELDKIKGLKLEELWLDGNTLCDTFRDQSTYISAIRERFPKLLRLDGHELPPP
IAFDVEAPTMLPPCKGSYFGTETLKNLVLHFLQQYYAVYDSGDRQRLLDAYHDGACCSLS
IPFIPQNPARSNLAEYFKDSRNVKKLKDPSLRFRLLKHTRLNVVAFLNELPKTQHDINSF
VVDISAQTSTLLCFSVNGVFKEVDGKSRDSLRAFTRTFVAVPGSNSGLCIVNDELFVRNA
SPDEIQRAFAMPAPTPSSSPVPTLSPEQQEMLQAFSTQSGMNLEWSQKCLQDNNWDYTRS
AQAFTHLKAKGEIPEVAFIK
Download sequence
Identical sequences ENSSSCP00000025799 ENSSSCP00000025799 NP_001230279.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]