SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000026002 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000026002
Domain Number 1 Region: 4-133
Classification Level Classification E-value
Superfamily NTF2-like 3.02e-36
Family NTF2-like 0.0029
Further Details:      
 
Domain Number 2 Region: 293-404
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.33e-19
Family Canonical RBD 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000026002   Gene: ENSSSCG00000022940   Transcript: ENSSSCT00000026131
Sequence length 448
Comment pep:known_by_projection chromosome:Sscrofa10.2:8:75410919:75440388:-1 gene:ENSSSCG00000022940 transcript:ENSSSCT00000026131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMEKPSPLLVGREFVRQYYTLLNKAPEYLHRFYGRNSSYVHGGVDASGKPQEAVYGQND
IHHKVLSLNFSECHTKIRHVDAHATLSDGVVVQVMGLLSNSGQPERKFMQTFVLAPEGSV
PNKFYVHNDMFRYEDEVFGDSEPELDEESEDEVEEEQEERQPTPEPVQETNSGYYEAHPV
TNGIEEPLEESSHEPEPEPESETKTEELKPQVEEKNLEELEEKSTSPPPAEPVSLPQEPP
KPRVETKPEVQSQPPRVREQRPRERPGFPPRGPRPGRGDIEQNESDNRRIIRYPDSHQLF
VGNLPHDIDENELKEFFMSFGNVVELRINTKGVGGKLPNFGFVVFDDSEPVQRILIAKPI
MFRGEVRLNVEEKKTRAARERETRGGGDDRRDIRRNDRGPGGPRGVVGGGMMRDRDGRGP
PPRGGMAQKLGSGRGTGQMEGRFTGQRR
Download sequence
Identical sequences A0A287AG37
XP_003357027.1.46622 XP_020957111.1.46622 XP_020957112.1.46622 ENSSSCP00000026002 ENSSSCP00000026002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]