SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000027838 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000027838
Domain Number 1 Region: 2-116
Classification Level Classification E-value
Superfamily L domain-like 5.27e-27
Family U2A'-like 0.025
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000027838
Domain Number - Region: 131-171
Classification Level Classification E-value
Superfamily Hypothetical protein MTH1880 0.0288
Family Hypothetical protein MTH1880 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000027838   Gene: ENSSSCG00000029825   Transcript: ENSSSCT00000029292
Sequence length 200
Comment pep:known chromosome:Sscrofa10.2:1:293302882:293310134:-1 gene:ENSSSCG00000029825 transcript:ENSSSCT00000029292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKLLKLRELNLSYNKICKIEGIENMHNLQKLNLAGNEIEHIPIWLGKKLKCLRVLNLKG
NKISSLQDVSKLKPLQDLTSLILAENPVATLPHYLQFTIFHLRSLESLEGQPVTTQDRQE
AFERFSLEEVERLERDLEKKVMETEELKSKQIRFLEEIKNQDKLNKSLKEEAMLQKQSCE
QLENNLNTKNELVSLYFTLL
Download sequence
Identical sequences ENSSSCP00000027838 ENSSSCP00000027838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]